Structure of PDB 5elt Chain B Binding Site BS01

Receptor Information
>5elt Chain B (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKEKYIDVVINKNM
KLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMR
DKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKF
LI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5elt Structural basis of RNA recognition and dimerization by the STAR proteins T-STAR and Sam68.
Resolution2.13 Å
Binding residue
(original residue number in PDB)		V73 G74 K75 L77 G78 P79 R80 G81 L84 K85 I97 R104
Binding residue
(residue number reindexed from 1)		V69 G70 K71 L73 G74 P75 R76 G77 L80 K81 I93 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5elt, PDBe:5elt, PDBj:5elt
PDBsum5elt
PubMed26758068
UniProtO75525|KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 (Gene Name=KHDRBS3)

[Back to BioLiP]