Structure of PDB 5elq Chain B Binding Site BS01

Receptor Information
>5elq Chain B (length=95) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGA
ADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5elq A molecular code for endosomal recycling of phosphorylated cargos by the SNX27-retromer complex.
Resolution1.1 Å
Binding residue
(original residue number in PDB)		G52 Y53 F55 N56 V57 R58 G59 Q60 V61 S82 H114
Binding residue
(residue number reindexed from 1)		G13 Y14 F16 N17 V18 R19 G20 Q21 V22 S43 H75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5elq, PDBe:5elq, PDBj:5elq
PDBsum5elq
PubMed27595347
UniProtQ8K4V4|SNX27_RAT Sorting nexin-27 (Gene Name=Snx27)

[Back to BioLiP]