Structure of PDB 5eim Chain B Binding Site BS01

Receptor Information
>5eim Chain B (length=161) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKGERISMINPRVVLDENGISHRSRYFIMLCDNETAIAHAKKTSIWAVKK
DSSKRISDAYKKASVYFIFVAQQTYNALGYAQVVSDLNSTELPFWSDSSH
AGGVRIKWIKTCNLFSAEISEIVSHMDHGSEARDGMEMMYDEGSRLCTLI
NYAIMKRIGRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eim Structural insights into the specific recognition of DSR by the YTH domain containing protein Mmi1
Resolution1.54 Å
Binding residue
(original residue number in PDB)		N414 R431
Binding residue
(residue number reindexed from 1)		N88 R105
Binding affinityPDBbind-CN: Kd=1.1uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5eim, PDBe:5eim, PDBj:5eim
PDBsum5eim
PubMed28735863
UniProtO74958|MMI1_SCHPO RNA binding exosome specificity factor Mmi1 (Gene Name=mmi1)

[Back to BioLiP]