Structure of PDB 5ego Chain B Binding Site BS01

Receptor Information
>5ego Chain B (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ego Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		R217 R220 I221 Y223 Q259 I262 N266 K270
Binding residue
(residue number reindexed from 1)		R1 R4 I5 Y7 Q43 I46 N50 K54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ego, PDBe:5ego, PDBj:5ego
PDBsum5ego
PubMed28473536
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]