Structure of PDB 5eg0 Chain B Binding Site BS01

Receptor Information
>5eg0 Chain B (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eg0 Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
Resolution3.101 Å
Binding residue
(original residue number in PDB)		R217 R220 P222 Y223 Q259 I262 N266 K270
Binding residue
(residue number reindexed from 1)		R1 R4 P6 Y7 Q43 I46 N50 K54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5eg0, PDBe:5eg0, PDBj:5eg0
PDBsum5eg0
PubMed
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]