Structure of PDB 5eay Chain B Binding Site BS01

Receptor Information
>5eay Chain B (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQLSEGAIAAIMQKGDTNIKPILQVINIRPITSPPRYRLLMSDGLNTLSS
FMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSA
EAVGVKIGNPVPYNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eay Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		E68 E106
Binding residue
(residue number reindexed from 1)		E63 E101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5eay, PDBe:5eay, PDBj:5eay
PDBsum5eay
PubMed26491943
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]