Structure of PDB 5e6c Chain B Binding Site BS01

Receptor Information
>5e6c Chain B (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNLEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e6c Cryptic glucocorticoid receptor-binding sites pervade genomic NF-kappa B response elements.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S440 R470
Binding residue
(residue number reindexed from 1)		S22 R52
Binding affinityPDBbind-CN: Kd=67.9uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5e6c, PDBe:5e6c, PDBj:5e6c
PDBsum5e6c
PubMed29626214
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]