Structure of PDB 5dzd Chain B Binding Site BS01

Receptor Information

>5dzd Chain B (length=39) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS

Ligand information

>5dzd Chain D (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EAPPCYMDVI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dzd Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide
Resolution	1.57 Å
Binding residue (original residue number in PDB)	R487 Y495 V497 H499 R502 T504 Y506
Binding residue (residue number reindexed from 1)	R12 Y20 V22 H24 R27 T29 Y31

Enzymatic activity

Enzyme Commision number

2.3.2.26: HECT-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5dzd, PDBe:5dzd, PDBj:5dzd
PDBsum	5dzd
PubMed
UniProt	Q96J02\|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog (Gene Name=ITCH)

[Back to BioLiP]