Structure of PDB 5dwb Chain B Binding Site BS01

Receptor Information

>5dwb Chain B (length=278) Species: 53501 (Thalassovita gelatinovora) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRLDLDFGRGLVAHVMLDNVSEEQYQQISDYFVPLVNKPKLKSRDAIGQA
FVMATEVCPDANPSDLWHHVLYRIYIREKIGTDPSQSWVRTSGEAFEVAL
VERYNPVLARHGIRLTALFKGQKGLALTRMGVADRVGSRKVDVMIEKQGG
GRSPDAEGFGVVGGIHAKVSLAERVSDDIPASRIMMGEGLLSVLSTLDVK
SFPPPHGDLVNRGELGTPDRPSDKRNYIEGHGDFSACFSYNLRTSPSNAT
TPSGRHIYVSGFSGQDDEFTDYLVAQLA

Ligand information

>5dwb Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttcgaccggtcga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dwb Restriction endonuclease AgeI is a monomer which dimerizes to cleave DNA.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	Y72 V89 R90 R139 K168 V169 S170 R174 K200 F202
Binding residue (residue number reindexed from 1)	Y72 V89 R90 R139 K168 V169 S170 R174 K200 F202

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5dwb, PDBe:5dwb, PDBj:5dwb
PDBsum	5dwb
PubMed	28039325
UniProt	Q9KHV6\|T2A1_THAGE Type II restriction enzyme AgeI (Gene Name=ageIR)

[Back to BioLiP]