Structure of PDB 5dir Chain B Binding Site BS01

Receptor Information
>5dir Chain B (length=149) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDVDRFGRLPWLWITVLVFVLDQVSKAFFQAELSMYQQIVVIPDLFSWTL
AYNTGAAFSGWQRWLFALIAIVVSASLVVWLKRLKKGETWLAIALALVLG
GALGNLYDRMVLGHVVDFILVHWQNRWYFPAFNLADSAITVGAVMLALD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dir Structural basis of lipoprotein signal peptidase II action and inhibition by the antibiotic globomycin.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T55 N112 R116 V122 D124 D143
Binding residue
(residue number reindexed from 1)		T54 N105 R109 V115 D117 D136
Enzymatic activity
Enzyme Commision number 3.4.23.36: signal peptidase II.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006465 signal peptide processing
GO:0006508 proteolysis
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dir, PDBe:5dir, PDBj:5dir
PDBsum5dir
PubMed26912896
UniProtQ9HVM5|LSPA_PSEAE Lipoprotein signal peptidase (Gene Name=lspA)

[Back to BioLiP]