Structure of PDB 5d8l Chain B Binding Site BS01

Receptor Information
>5d8l Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKH
NNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLE
NIKRKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d8l Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
Resolution2.069 Å
Binding residue
(original residue number in PDB)		F10 K54 H55 S60 R63 Q64 Y68 R109
Binding residue
(residue number reindexed from 1)		F5 K49 H50 S55 R58 Q59 Y63 R104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d8l, PDBe:5d8l, PDBj:5d8l
PDBsum5d8l
PubMed26727490
UniProtQ03933|HSF2_HUMAN Heat shock factor protein 2 (Gene Name=HSF2)

[Back to BioLiP]