Structure of PDB 5d52 Chain B Binding Site BS01

Receptor Information

>5d52 Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>5d52 Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5d52 In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	V2 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 A30
Binding residue (residue number reindexed from 1)	V2 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 A30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5d52, PDBe:5d52, PDBj:5d52
PDBsum	5d52
PubMed	26894538
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]