Structure of PDB 5cul Chain B Binding Site BS01

Receptor Information
>5cul Chain B (length=79) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTHVAIGIRYRRGETPLPLVTLKHTDALALRVRRIAEEEGIPVLQRIPLA
RALLRDGNVDQYIPADLIQATAEVLRWLE
Ligand information
>5cul Chain A (length=28) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKRRQFHQELQSSNLRADVRRSSVIVAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cul The Structure of a Type 3 Secretion System (T3SS) Ruler Protein Suggests a Molecular Mechanism for Needle Length Sensing.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V51 A52 I53 I55 R56 Y57 T68 L69 H71 I82 A83 E85 E86 I88 P89 V90 L91 Q92 R93 I94 A97 D107
Binding residue
(residue number reindexed from 1)		V4 A5 I6 I8 R9 Y10 T21 L22 H24 I35 A36 E38 E39 I41 P42 V43 L44 Q45 R46 I47 A50 D60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cul, PDBe:5cul, PDBj:5cul
PDBsum5cul
PubMed26589798
UniProtQ9I337

[Back to BioLiP]