Structure of PDB 5crx Chain B Binding Site BS01

Receptor Information
>5crx Chain B (length=296) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEP
EDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMR
RIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAY
NTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVT
KLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEAT
HRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5crx Asymmetric DNA bending in the Cre-loxP site-specific recombination synapse.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		M44 S47 R50 R81 L83 A84 K86 T87 R118 K122 K132 Q156 R159 R173 K201 R241 V242 R243 K244 L256 S257 R282 Y283 R292
Binding residue
(residue number reindexed from 1)		M26 S29 R32 R63 L65 A66 K68 T69 R100 K104 K114 Q138 R141 R155 K183 R223 V224 R225 K226 L238 S239 R264 Y265 R274
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5crx, PDBe:5crx, PDBj:5crx
PDBsum5crx
PubMed10377382
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]