Structure of PDB 5cr2 Chain B Binding Site BS01

Receptor Information

>5cr2 Chain B (length=108) Species: 83333 (Escherichia coli K-12)

RYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTT
QSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIK
AKINVLIG

Ligand information

>5cr2 Chain E (length=3)

aua

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5cr2 Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): W14 R29 P30 T52 T53 E68 R69 K91
• Binding residue (residue number reindexed from 1): W11 R26 P27 T49 T50 E65 R66 K88
• Binding affinity: PDBbind-CN: Kd=0.52uM

Enzymatic activity

• Enzyme Commision number: 3.1.27.-

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity
• GO:0044877 protein-containing complex binding
• GO:0140677 molecular function activator activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0009372 quorum sensing
• GO:0016075 rRNA catabolic process
• GO:0030308 negative regulation of cell growth
• GO:0040008 regulation of growth
• GO:0043068 positive regulation of programmed cell death
• GO:0044010 single-species biofilm formation
• GO:0051607 defense response to virus

Cellular Component

• GO:0032991 protein-containing complex
• GO:0110001 toxin-antitoxin complex

External links

• PDB: RCSB:5cr2, PDBe:5cr2, PDBj:5cr2
• PDBsum: 5cr2
• PubMed: 27026704
• UniProt: P0AE70|MAZF_ECOLI Endoribonuclease toxin MazF (Gene Name=mazF)