Structure of PDB 5ciz Chain B Binding Site BS01

Receptor Information
>5ciz Chain B (length=74) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKK
SLTEIKDVLASRGLSLGMRLENWP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ciz The RNA Polymerase alpha Subunit Recognizes the DNA Shape of the Upstream Promoter Element
Resolution5.0098 Å
Binding residue
(original residue number in PDB)		R265 P293 N294 G296 K298 S299
Binding residue
(residue number reindexed from 1)		R17 P45 N46 G48 K50 S51
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ciz, PDBe:5ciz, PDBj:5ciz
PDBsum5ciz
PubMed
UniProtP0A7Z4|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]