Structure of PDB 5cdq Chain B Binding Site BS01

Receptor Information

>5cdq Chain B (length=191) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNV
EKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGA
HIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNP
EHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVY

Ligand information

>5cdq Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gagcgtatggccatacgctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5cdq Structural basis of DNA gyrase inhibition by antibacterial QPT-1, anticancer drug etoposide and moxifloxacin.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	K460 L462 N463 K466 R471 N475 H515 V626 R629
Binding residue (residue number reindexed from 1)	K46 L48 N49 K52 R57 N61 H101 V178 R181

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5cdq, PDBe:5cdq, PDBj:5cdq
PDBsum	5cdq
PubMed	26640131
UniProt	P66937\|GYRB_STAAN DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]