Structure of PDB 5cc0 Chain B Binding Site BS01

Receptor Information

>5cc0 Chain B (length=72) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRLRKCLQAGMTLG

Ligand information

>5cc0 Chain C (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcctccgggagagct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5cc0 Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
Resolution	2.405 Å
Binding residue (original residue number in PDB)	S440 R447 R470 K471 R477
Binding residue (residue number reindexed from 1)	S23 R30 R53 K54 R60
Binding affinity	PDBbind-CN: Kd=0.369uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5cc0, PDBe:5cc0, PDBj:5cc0
PDBsum	5cc0
PubMed	26715749
UniProt	P06401\|PRGR_HUMAN Progesterone receptor (Gene Name=PGR)

[Back to BioLiP]