Structure of PDB 5c7f Chain B Binding Site BS01

Receptor Information

>5c7f Chain B (length=199) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEW
DEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKD
LKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKL
IEANPLFREKLVFPTLKASRLRTLINQSLNWQHQLCKNPIKTLFTDHTC

Ligand information

>5c7f Chain F (length=8) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELRLGLPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5c7f Structural basis for recognition of diverse transcriptional repressors by the TOPLESS family of corepressors.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	K71 F74 K78 L111 Q129 L130
Binding residue (residue number reindexed from 1)	K71 F74 K78 L111 Q129 L130

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Biological Process

External links

PDB	RCSB:5c7f, PDBe:5c7f, PDBj:5c7f
PDBsum	5c7f
PubMed	26601214
UniProt	Q5NBT9\|TPR1_ORYSJ Protein TPR1 (Gene Name=TPR1)

[Back to BioLiP]