Structure of PDB 5bw8 Chain B Binding Site BS01

Receptor Information
>5bw8 Chain B (length=304) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFL
LISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAS
IPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNT
LSKLLEKFNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLY
ETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
EDKE
Ligand information
>5bw8 Chain Z (length=13) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bw8 Mechanism of Assembly of a Substrate Transfer Complex during Tail-anchored Protein Targeting.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N98 V210 K215
Binding residue
(residue number reindexed from 1)		N96 V160 K165
Enzymatic activity
Catalytic site (original residue number in PDB) G28 G30 K31 T32 T33 D57
Catalytic site (residue number reindexed from 1) G26 G28 K29 T30 T31 D55
Enzyme Commision number 3.6.-.-
Gene Ontology
Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
GO:0044183 protein folding chaperone
GO:0046872 metal ion binding
GO:0051082 unfolded protein binding
Biological Process
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0006457 protein folding
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0009408 response to heat
GO:0010038 response to metal ion
GO:0016192 vesicle-mediated transport
GO:0034599 cellular response to oxidative stress
GO:0045048 protein insertion into ER membrane
GO:0046685 response to arsenic-containing substance
GO:0071816 tail-anchored membrane protein insertion into ER membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0043529 GET complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5bw8, PDBe:5bw8, PDBj:5bw8
PDBsum5bw8
PubMed26451041
UniProtQ12154|GET3_YEAST ATPase GET3 (Gene Name=GET3)

[Back to BioLiP]