Structure of PDB 5bsa Chain B Binding Site BS01

Receptor Information
>5bsa Chain B (length=76) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>5bsa Chain F (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FIEDEGEPQEEMSKHIREIFGYD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bsa Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2.
Resolution4.611 Å
Binding residue
(original residue number in PDB)
A98 Y99
Binding residue
(residue number reindexed from 1)
A39 Y40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5bsa, PDBe:5bsa, PDBj:5bsa
PDBsum5bsa
PubMed26109053
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]