Structure of PDB 5bs2 Chain B Binding Site BS01

Receptor Information
>5bs2 Chain B (length=113) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASPERKAAVALRSLFTFVAARVVLEQLQGPGGPETTYNQQAYLDLMDFLG
TPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRET
REANTRLMRAAAM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bs2 Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		S56 L57 F60 M89
Binding residue
(residue number reindexed from 1)		S13 L14 F17 M46
Enzymatic activity
Enzyme Commision number 4.1.1.39: ribulose-bisphosphate carboxylase.
Gene Ontology
Molecular Function
GO:0044183 protein folding chaperone
Biological Process
GO:0110102 ribulose bisphosphate carboxylase complex assembly

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5bs2, PDBe:5bs2, PDBj:5bs2
PDBsum5bs2
PubMed26305355
UniProtP00877|RBL_CHLRE Ribulose bisphosphate carboxylase large chain (Gene Name=rbcL)

[Back to BioLiP]