Structure of PDB 5brm Chain B Binding Site BS01

Receptor Information
>5brm Chain B (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGT
NIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSVPFPKNFMSVAKTILKR
LFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPL
QELIEKLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5brm Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
Resolution2.651 Å
Binding residue
(original residue number in PDB)
P91 R92 Y93 E94 Y95 H96 K153 R154 R157 Y163 F167 M171 R199 E200 L207 K210
Binding residue
(residue number reindexed from 1)
P40 R41 Y42 E43 Y44 H45 K99 R100 R103 Y109 F113 M117 R145 E146 L153 K156
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5brm, PDBe:5brm, PDBj:5brm
PDBsum5brm
PubMed26108669
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]