Structure of PDB 5b1l Chain B Binding Site BS01

Receptor Information
>5b1l Chain B (length=78) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE
HAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>5b1l Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcca
tcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5b1l Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
Resolution2.35 Å
Binding residue
(original residue number in PDB)		P32 R36 R45
Binding residue
(residue number reindexed from 1)		P8 R12 R21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b1l, PDBe:5b1l, PDBj:5b1l
PDBsum5b1l
PubMed28099840
UniProtP62806|H4_MOUSE Histone H4 (Gene Name=H4c1)

[Back to BioLiP]