Structure of PDB 5axi Chain B Binding Site BS01

Receptor Information

>5axi Chain B (length=302) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLIL
SKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQD
RRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDK
TIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRL
FQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSC
TRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNP
DL

Ligand information

>5axi Chain E (length=5) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DGYMP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5axi Structural analysis of the TKB domain of ubiquitin ligase Cbl-b complexed with its small inhibitory peptide, Cblin
Resolution	2.5 Å
Binding residue (original residue number in PDB)	Y266 K270 R286 S288 C289 T290 Q308 I310
Binding residue (residue number reindexed from 1)	Y227 K231 R247 S249 C250 T251 Q269 I271

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0001784	phosphotyrosine residue binding
GO:0004842	ubiquitin-protein transferase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0007166	cell surface receptor signaling pathway
GO:0023051	regulation of signaling

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5axi, PDBe:5axi, PDBj:5axi
PDBsum	5axi
PubMed	26874193
UniProt	Q3TTA7\|CBLB_MOUSE E3 ubiquitin-protein ligase CBL-B (Gene Name=Cblb)

[Back to BioLiP]