Structure of PDB 5afp Chain B Binding Site BS01

Receptor Information
>5afp Chain B (length=171) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFP
FGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKL
YDLDNDGYITRNEMLDIVDAIYQMVPEEENTPEKRVDRIFAMMDKNADGK
LTLQEFQEGSKADPSIVQALS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5afp Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-Protein Coupled Receptor Kinase 1 (Grk1) Peptides Using Different Modes of Interactions.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I51 Y52 F56 F64 T92 S93 K100 L107 Y108 I128 R148 I152 F169 I179
Binding residue
(residue number reindexed from 1)		I44 Y45 F49 F57 T85 S86 K93 L100 Y101 I121 R135 I139 F156 I166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005245 voltage-gated calcium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008048 calcium sensitive guanylate cyclase activator activity
GO:0008427 calcium-dependent protein kinase inhibitor activity
GO:0019901 protein kinase binding
GO:0046872 metal ion binding
Biological Process
GO:0010975 regulation of neuron projection development
GO:0045921 positive regulation of exocytosis
GO:0050850 positive regulation of calcium-mediated signaling
GO:0070588 calcium ion transmembrane transport
GO:0099509 regulation of presynaptic cytosolic calcium ion concentration
GO:2000300 regulation of synaptic vesicle exocytosis
Cellular Component
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0030424 axon
GO:0030425 dendrite
GO:0031045 dense core granule
GO:0044305 calyx of Held
GO:0045202 synapse
GO:0048471 perinuclear region of cytoplasm
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5afp, PDBe:5afp, PDBj:5afp
PDBsum5afp
PubMed25979333
UniProtP62168|NCS1_RAT Neuronal calcium sensor 1 (Gene Name=Ncs1)

[Back to BioLiP]