Structure of PDB 5a77 Chain B Binding Site BS01

Receptor Information
>5a77 Chain B (length=158) Species: 3077 (Chlorella vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLQLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a77 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R33 D35 Y36 L37 Q41 R71 R73 N74 D75 G84 K120
Binding residue
(residue number reindexed from 1)		R28 D30 Y31 L32 Q36 R66 R68 N69 D70 G79 K115
Binding affinityPDBbind-CN: Kd=315nM
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a77, PDBe:5a77, PDBj:5a77
PDBsum5a77
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]