Structure of PDB 5a3d Chain B Binding Site BS01

Receptor Information
>5a3d Chain B (length=115) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYF
LTDPELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGL
DEEWQRREEGKAHRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a3d Structural Insights Into the Recognition of Cisplatin and Aaf-Dg Lesion by Rad14 (Xpa).
Resolution1.8 Å
Binding residue
(original residue number in PDB)		P241 T261 F262
Binding residue
(residue number reindexed from 1)		P54 T74 F75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
Biological Process
GO:0006289 nucleotide-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5a3d, PDBe:5a3d, PDBj:5a3d
PDBsum5a3d
PubMed26100901
UniProtP28519|RAD14_YEAST DNA repair protein RAD14 (Gene Name=RAD14)

[Back to BioLiP]