Structure of PDB 5a0r Chain B Binding Site BS01

Receptor Information
>5a0r Chain B (length=192) Species: 272563 (Clostridioides difficile 630) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTIQQNKDTLSQIVVFPTGNYDKNEANAMVNRLANIDGKYLNALKQNNLK
IKLLSGKLTDEKEYAYLKGVVPKGWEGTGKTWDDVPGLGGSTVALRIGFS
NKGKGHDAINLELHATAHAIDHIVLNDISKSAQFKQIFAKEGRSLGNVNY
LGVYPEEFFAESFAYYYLNQDTNSKLKSACPQTYSFLQNLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a0r Structural Basis of Proline-Proline Peptide Bond Specificity of the Metalloprotease Zmp1 Implicated in Motility of Clostridium Difficile.
Resolution1.251 Å
Binding residue
(original residue number in PDB)		W110 L116 G117 G118 S119 H142 H146 Y178 E185
Binding residue
(residue number reindexed from 1)		W82 L88 G89 G90 S91 H114 H118 Y150 E157
Enzymatic activity
Enzyme Commision number 3.4.24.89: Pro-Pro endopeptidase.
Gene Ontology
Molecular Function
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a0r, PDBe:5a0r, PDBj:5a0r
PDBsum5a0r
PubMed26211609
UniProtQ183R7|PPEP1_CLOD6 Pro-Pro endopeptidase (Gene Name=zmp1)

[Back to BioLiP]