Structure of PDB 5a0m Chain B Binding Site BS01

Receptor Information

>5a0m Chain B (length=227) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRD
EGKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGA
QTFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDY
NKNSTNTSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYID
SMSYLIFYNLIKPYLIPQMMYKLPNTI

Ligand information

>5a0m Chain E (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cacgctagggataa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5a0m Structure of the I-Scei Nuclease Complexed with its DsDNA Target and Three Catalytic Metal Ions.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	D344 E361 W362 K363 N390 L392 N394 V396 W449 N452 K493
Binding residue (residue number reindexed from 1)	D43 E60 W61 K62 N89 L91 N93 V95 W148 N151 K192

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005739	mitochondrion

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5a0m, PDBe:5a0m, PDBj:5a0m
PDBsum	5a0m
PubMed	27303901
UniProt	P03882\|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)

[Back to BioLiP]