Structure of PDB 4zvp Chain B Binding Site BS01

Receptor Information
>4zvp Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKIPVEADFLFAYSTVPGYVSMRSPGRGSWFVQALCSILEEHGKDLEIMQ
ILTRVNDRVARHFESCSDDPHFHEKKQIPCVVSMLTKELYFSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zvp Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S231 M232 R233 P235 S275 C276
Binding residue
(residue number reindexed from 1)		S21 M22 R23 P25 S65 C66
Enzymatic activity
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4zvp, PDBe:4zvp, PDBj:4zvp
PDBsum4zvp
PubMed27032039
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]