Structure of PDB 4zbn Chain B Binding Site BS01

Receptor Information
>4zbn Chain B (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNSVFKQYFFET
KCRDSGCRGIDSKHWNSYCTTTHTFVKALTMAAWRFIRIDTACVCVLSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zbn Non-helical DNA Triplex Forms a Unique Aptamer Scaffold for High Affinity Recognition of Nerve Growth Factor.
Resolution2.447 Å
Binding residue
(original residue number in PDB)		I31 K32 W76 F86 F101 R103
Binding residue
(residue number reindexed from 1)		I28 K29 W65 F75 F86 R88
Binding affinityPDBbind-CN: Kd=0.21nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding

View graph for
Molecular Function
External links
PDB RCSB:4zbn, PDBe:4zbn, PDBj:4zbn
PDBsum4zbn
PubMed26027732
UniProtP01138|NGF_HUMAN Beta-nerve growth factor (Gene Name=NGF)

[Back to BioLiP]