Structure of PDB 4z8m Chain B Binding Site BS01

Receptor Information
>4z8m Chain B (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT
AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEI
MDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV
STRFDLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z8m Structural Insights into Mitochondrial Antiviral Signaling Protein (MAVS)-Tumor Necrosis Factor Receptor-associated Factor 6 (TRAF6) Signaling
Resolution2.95 Å
Binding residue
(original residue number in PDB)		E455 L457
Binding residue
(residue number reindexed from 1)		E106 L108
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0016567 protein ubiquitination
GO:0043122 regulation of canonical NF-kappaB signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4z8m, PDBe:4z8m, PDBj:4z8m
PDBsum4z8m
PubMed26385923
UniProtQ9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 (Gene Name=TRAF6)

[Back to BioLiP]