Structure of PDB 4z88 Chain B Binding Site BS01

Receptor Information

>4z88 Chain B (length=66) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGEL
RGRRGYVPHNMVSEVE

Ligand information

>4z88 Chain N (length=5) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LPEIP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution	2.09 Å
Binding residue (original residue number in PDB)	F1324 Y1326 P1374 N1376 M1377
Binding residue (residue number reindexed from 1)	F8 Y10 P58 N60 M61

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:4z88, PDBe:4z88, PDBj:4z88
PDBsum	4z88
PubMed	26274777
UniProt	A0A0B4JDC9

[Back to BioLiP]