Structure of PDB 4z7k Chain B Binding Site BS01

Receptor Information
>4z7k Chain B (length=195) Species: 402880 (Methanococcus maripaludis C5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDLEYMHISYPNILLNMRDGSKLRGYFAKKYIDYKYPQIQFKIIDRSPLI
IGIGSLGINFLESKRIFFEKETEVNVHKDMDHFGTTDKILKYQFKTPWMA
LNAKNSEIYKNSDEIDREEFLKRVLIGNILSMSKSLGYTIEEKLKVKINL
KEVPVKFKNQNMVGFRGEFYINFDIPQYLGIGRNVSRGFGTVVKV
Ligand information
>4z7k Chain C (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaauaacuugcaaaauaacaagcau
.........<<..........>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z7k A Non-Stem-Loop CRISPR RNA Is Processed by Dual Binding Cas6.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N125 N128 R146 G150 N151 L153 S154 K157 T162 I163 K166 L167 K181 N182 R206 N207
Binding residue
(residue number reindexed from 1)		N102 N105 R123 G127 N128 L130 S131 K134 T139 I140 K143 L144 K158 N159 R183 N184
Binding affinityPDBbind-CN: Kd=0.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042802 identical protein binding

View graph for
Molecular Function
External links
PDB RCSB:4z7k, PDBe:4z7k, PDBj:4z7k
PDBsum4z7k
PubMed26996962
UniProtA4FXZ3

[Back to BioLiP]