Structure of PDB 4z5d Chain B Binding Site BS01

Receptor Information
>4z5d Chain B (length=71) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT
LTTFFKILQSLELSMTLCDAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z5d Molecular mechanism on hipBA gene regulation.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		R21 T27 Q28 Q39 S43 N47
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 Q36 S40 N44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4z5d, PDBe:4z5d, PDBj:4z5d
PDBsum4z5d
PubMed
UniProtP23873|HIPB_ECOLI Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]