Structure of PDB 4z33 Chain B Binding Site BS01

Receptor Information
>4z33 Chain B (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQ
INGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG
FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILST
SGTVVTITIMPAFIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z33 Crystal structure of the syntenin PDZ1 and PDZ2 tandem in complex with the Frizzled 7 C-terminal fragment and PIP2
Resolution2.45 Å
Binding residue
(original residue number in PDB)
H208 V209 G210 F211 I212 F213 L258
Binding residue
(residue number reindexed from 1)
H98 V99 G100 F101 I102 F103 L148
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4z33, PDBe:4z33, PDBj:4z33
PDBsum4z33
PubMed
UniProtO00560|SDCB1_HUMAN Syntenin-1 (Gene Name=SDCBP)

[Back to BioLiP]