Structure of PDB 4z2v Chain B Binding Site BS01

Receptor Information
>4z2v Chain B (length=126) Species: 411684 (Hoeflea phototrophica DFL-43) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPDMKLLAGASNWVNQSGSVAQFVFTPSPTQPQTYEVSGNYINNAQGTGC
KGTPYPLSGAYYSGNQIISFSVVWSNASANCQSATGWTGYFDFSGSQAVL
KTDWNLAFYSGSTPAIQQGQDDFMQS
Ligand information
>4z2v Chain C (length=11) Species: 411684 (Hoeflea phototrophica DFL-43) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VATVSESLLTE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z2v Hoefavidin: A dimeric bacterial avidin with a C-terminal binding tail.
Resolution1.39 Å
Binding residue
(original residue number in PDB)		T55 G56 W81 A84 S85 A86 N87 C88 Q89 S90 L113 F115 S117 G118
Binding residue
(residue number reindexed from 1)		T48 G49 W74 A77 S78 A79 N80 C81 Q82 S83 L106 F108 S110 G111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4z2v, PDBe:4z2v, PDBj:4z2v
PDBsum4z2v
PubMed26126731
UniProtA9D857|HOAVI_HOEPD Hoefavidin (Gene Name=HPDFL43_17171)

[Back to BioLiP]