Structure of PDB 4z2p Chain B Binding Site BS01

Receptor Information
>4z2p Chain B (length=126) Species: 411684 (Hoeflea phototrophica DFL-43) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPDMKLLAGASNWVNQSGSVAQFVFTPSPTQPQTYEVSGNYINNAQGTGC
KGTPYPLSGAYYSGNQIISFSVVWSNASANCQSATGWTGYFDFSGSQAVL
KTDWNLAFYSGSTPAIQQGQDDFMQS
Ligand information
>4z2p Chain C (length=11) Species: 411684 (Hoeflea phototrophica DFL-43) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VATVSESFLTE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z2p Hoefavidin: A dimeric bacterial avidin with a C-terminal binding tail.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		N50 T55 G56 W81 A84 S85 A86 N87 C88 Q89 S90 L113 F115 S117
Binding residue
(residue number reindexed from 1)		N43 T48 G49 W74 A77 S78 A79 N80 C81 Q82 S83 L106 F108 S110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4z2p, PDBe:4z2p, PDBj:4z2p
PDBsum4z2p
PubMed26126731
UniProtA9D857|HOAVI_HOEPD Hoefavidin (Gene Name=HPDFL43_17171)

[Back to BioLiP]