Structure of PDB 4z0x Chain B Binding Site BS01

Receptor Information
>4z0x Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAEVKKPGSSVKVSCEANYVITWVRQAPGQGLEWMGGFIPDFRTAMYAQG
FQGRVTITADLAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGPGTLVTV
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z0x Affinity maturation of a broadly neutralizing human monoclonal antibody that prevents acute hepatitis C virus infection in mice.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		I52 F55 M59 S102 G104
Binding residue
(residue number reindexed from 1)		I39 F42 M46 S85 G87
External links