Structure of PDB 4z0r Chain B Binding Site BS01

Receptor Information
>4z0r Chain B (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNC
SISEEDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z0r Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide
Resolution1.75 Å
Binding residue
(original residue number in PDB)		N27 K28 V29 W30 V31 Q32 W41 S45 S46 H54 E56
Binding residue
(residue number reindexed from 1)		N6 K7 V8 W9 V10 Q11 W20 S24 S25 H33 E35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4z0r, PDBe:4z0r, PDBj:4z0r
PDBsum4z0r
PubMed
UniProtQ504Y3|ZCPW2_HUMAN Zinc finger CW-type PWWP domain protein 2 (Gene Name=ZCWPW2)

[Back to BioLiP]