Structure of PDB 4yyn Chain B Binding Site BS01

Receptor Information
>4yyn Chain B (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLE
TIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCY
QTLTEYDEHLTQLEKDICTAKEAALEEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yyn A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		D1524 P1527 F1528 V1532 F1536 N1583 Y1589
Binding residue
(residue number reindexed from 1)		D23 P26 F27 V31 F35 N82 Y88
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
Cellular Component
GO:0005669 transcription factor TFIID complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yyn, PDBe:4yyn, PDBj:4yyn
PDBsum4yyn
PubMed26365797
UniProtP21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 (Gene Name=TAF1)

[Back to BioLiP]