Structure of PDB 4yyk Chain B Binding Site BS01

Receptor Information
>4yyk Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMK
DKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMM
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yyk A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
Resolution1.79 Å
Binding residue
(original residue number in PDB)
F45 I53 P55 Y106
Binding residue
(residue number reindexed from 1)
F24 I32 P34 Y85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4yyk, PDBe:4yyk, PDBj:4yyk
PDBsum4yyk
PubMed26365797
UniProtQ9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 (Gene Name=BRD9)

[Back to BioLiP]