Structure of PDB 4yxb Chain B Binding Site BS01

Receptor Information
>4yxb Chain B (length=172) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNWRDNLVRQVQHSELELVANFADIPLRLSQILKLKPGDVLPIEKPDRII
AHVDGVPVLTSQYGTVNGQYALRVEHLINPILNSLNEDIDLIMDIPVKLT
VELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVA
DKYGVRITDIITPSERMRRLSR
Ligand information
>4yxb Chain E (length=6) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yxb A common assembly module in injectisome and flagellar type III secretion sorting platforms.
Resolution2.56 Å
Binding residue
(original residue number in PDB)		T68 V69 Y73
Binding residue
(residue number reindexed from 1)		T65 V66 Y70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003774 cytoskeletal motor activity
Biological Process
GO:0006935 chemotaxis
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005886 plasma membrane
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yxb, PDBe:4yxb, PDBj:4yxb
PDBsum4yxb
PubMed25994170
UniProtP26418;
P26419

[Back to BioLiP]