Structure of PDB 4ywc Chain B Binding Site BS01

Receptor Information
>4ywc Chain B (length=179) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAAAQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILG
WGDGYYKGEENTAEQEHRKRVIRELNSLISGNDEEVTDTEWFFLVSMTQS
FVNGVGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIAT
QNGVVELGSSEVISQSSDLMHKVNNLFNF
Ligand information
>4ywc Chain C (length=22) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVPQARKASLARFLEKRKERLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ywc Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D50 Q54 A58 N233 L234
Binding residue
(residue number reindexed from 1)		D9 Q13 A17 N175 L176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ywc, PDBe:4ywc, PDBj:4ywc
PDBsum4ywc
PubMed26258305
UniProtQ9FIP9|MYC3_ARATH Transcription factor MYC3 (Gene Name=MYC3)

[Back to BioLiP]