Structure of PDB 4yj0 Chain B Binding Site BS01

Receptor Information
>4yj0 Chain B (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQ
VALRRQQAQEEEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yj0 An ancient protein-DNA interaction underlying metazoan sex determination.
Resolution3.814 Å
Binding residue
(original residue number in PDB)
R72 P74 K89 K92 R122
Binding residue
(residue number reindexed from 1)
R4 P6 K21 K24 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4yj0, PDBe:4yj0, PDBj:4yj0
PDBsum4yj0
PubMed26005864
UniProtQ9Y5R6|DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 (Gene Name=DMRT1)

[Back to BioLiP]