Structure of PDB 4yhw Chain B Binding Site BS01

Receptor Information
>4yhw Chain B (length=133) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVYHCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVG
NEKSCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQD
CKFKGWFMKVCNDQDSLLRTLGQFDSEHFYSPV
Ligand information
>4yhw Chain F (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuccccugcauaaggaugaaccguuuu
...........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yhw A composite double-/single-stranded RNA-binding region in protein Prp3 supports tri-snRNP stability and splicing.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		P350 K351 R353 F354 K357 K361 R371 D374 G439 W440 F441 M442 Q457
Binding residue
(residue number reindexed from 1)		P16 K17 R19 F20 K23 K27 R37 D40 G105 W106 F107 M108 Q123
Binding affinityPDBbind-CN: Kd=110nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yhw, PDBe:4yhw, PDBj:4yhw
PDBsum4yhw
PubMed26161500
UniProtQ03338|PRP3_YEAST U4/U6 small nuclear ribonucleoprotein PRP3 (Gene Name=PRP3)

[Back to BioLiP]