Structure of PDB 4yh1 Chain B Binding Site BS01

Receptor Information
>4yh1 Chain B (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQ
VYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARL
FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWF
DNMSDTELHDLLPFFEQLSRVDDVYSVLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yh1 Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
N96 L97 D98 F106 I120 T152 A153 S154 R178
Binding residue
(residue number reindexed from 1)
N20 L21 D22 F30 I44 T76 A77 S78 R102
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Gene Ontology
Molecular Function
GO:0016791 phosphatase activity

View graph for
Molecular Function
External links
PDB RCSB:4yh1, PDBe:4yh1, PDBj:4yh1
PDBsum4yh1
PubMed26332362
UniProtQ9GZU7|CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (Gene Name=CTDSP1)

[Back to BioLiP]