Structure of PDB 4ygw Chain B Binding Site BS01

Receptor Information
>4ygw Chain B (length=103) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTN
CYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFD
ASV
Ligand information
>4ygw Chain b (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KETAAMKFEMQHMDS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ygw Acetone-Linked Peptides: A Convergent Approach for Peptide Macrocyclization and Labeling.
Resolution2.18 Å
Binding residue
(original residue number in PDB)		Y25 R33 K41 N44 T45 F46 V47 H48 E49 L51 V54 P117 V118 H119 F120
Binding residue
(residue number reindexed from 1)		Y4 R12 K20 N23 T24 F25 V26 H27 E28 L30 V33 P96 V97 H98 F99
Enzymatic activity
Catalytic site (original residue number in PDB) K41 H119 F120 D121
Catalytic site (residue number reindexed from 1) K20 H98 F99 D100
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4ygw, PDBe:4ygw, PDBj:4ygw
PDBsum4ygw
PubMed26096515
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]