Structure of PDB 4yg4 Chain B Binding Site BS01

Receptor Information
>4yg4 Chain B (length=71) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT
LTTFFKILQSLELSMTLCDAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yg4 HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R21 T27 Q28 S43 N47
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 S40 N44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4yg4, PDBe:4yg4, PDBj:4yg4
PDBsum4yg4
PubMed26222023
UniProtP23873|HIPB_ECOLI Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]